mirror of
https://github.com/sparrowwallet/sparrow.git
synced 2024-11-04 13:26:44 +00:00
break out UR implementation into hummingbird project
This commit is contained in:
parent
998100505d
commit
ff578c938e
19 changed files with 16 additions and 1802 deletions
|
@ -1,19 +0,0 @@
|
|||
BSD-2-Clause Plus Patent License
|
||||
|
||||
SPDX-License-Identifier: [BSD-2-Clause-Patent](https://spdx.org/licenses/BSD-2-Clause-Patent.html)
|
||||
|
||||
Copyright © 2020 Blockchain Commons, LLC
|
||||
|
||||
Redistribution and use in source and binary forms, with or without modification, are permitted provided that the following conditions are met:
|
||||
|
||||
1. Redistributions of source code must retain the above copyright notice, this list of conditions and the following disclaimer.
|
||||
2. Redistributions in binary form must reproduce the above copyright notice, this list of conditions and the following disclaimer in the documentation and/or other materials provided with the distribution.
|
||||
Subject to the terms and conditions of this license, each copyright holder and contributor hereby grants to those receiving rights under this license a perpetual, worldwide, non-exclusive, no-charge, royalty-free, irrevocable (except for failure to satisfy the conditions of this license) patent license to make, have made, use, offer to sell, sell, import, and otherwise transfer this software, where such license applies only to those patent claims, already acquired or hereafter acquired, licensable by such copyright holder or contributor that are necessarily infringed by:
|
||||
|
||||
(a) their Contribution(s) (the licensed copyrights of copyright holders and non-copyrightable additions of contributors, in source or binary form) alone; or
|
||||
(b) combination of their Contribution(s) with the work of authorship to which such Contribution(s) was added by such copyright holder or contributor, if, at the time the Contribution is added, such addition causes such combination to be necessarily infringed. The patent license shall not apply to any other combinations which include the Contribution.
|
||||
Except as expressly stated above, no rights or licenses from any copyright holder or contributor is granted under this license, whether expressly, by implication, estoppel or otherwise.
|
||||
|
||||
DISCLAIMER
|
||||
|
||||
THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT HOLDERS OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
|
|
@ -50,7 +50,7 @@ dependencies {
|
|||
implementation('com.github.arteam:simple-json-rpc-server:1.0') {
|
||||
exclude group: 'org.slf4j'
|
||||
}
|
||||
implementation('co.nstant.in:cbor:0.9')
|
||||
implementation('com.sparrowwallet:hummingbird:1.2')
|
||||
implementation('com.nativelibs4java:bridj:0.7-20200803')
|
||||
implementation('com.github.sarxos:webcam-capture:0.3.13-SNAPSHOT') {
|
||||
exclude group: 'com.nativelibs4java', module: 'bridj'
|
||||
|
|
|
@ -7,8 +7,8 @@ import com.google.zxing.common.BitMatrix;
|
|||
import com.google.zxing.qrcode.QRCodeWriter;
|
||||
import com.sparrowwallet.sparrow.AppController;
|
||||
import com.sparrowwallet.sparrow.io.ImportException;
|
||||
import com.sparrowwallet.sparrow.ur.UR;
|
||||
import com.sparrowwallet.sparrow.ur.UREncoder;
|
||||
import com.sparrowwallet.hummingbird.UR;
|
||||
import com.sparrowwallet.hummingbird.UREncoder;
|
||||
import javafx.concurrent.ScheduledService;
|
||||
import javafx.concurrent.Task;
|
||||
import javafx.scene.control.ButtonBar;
|
||||
|
@ -39,8 +39,8 @@ public class QRDisplayDialog extends Dialog<UR> {
|
|||
|
||||
private String currentPart;
|
||||
|
||||
public QRDisplayDialog(byte[] data) {
|
||||
this(UR.fromBytes(data));
|
||||
public QRDisplayDialog(String type, byte[] data) throws UR.URException {
|
||||
this(UR.fromBytes(type, data));
|
||||
}
|
||||
|
||||
public QRDisplayDialog(UR ur) {
|
||||
|
|
|
@ -9,9 +9,9 @@ import com.sparrowwallet.drongo.protocol.Transaction;
|
|||
import com.sparrowwallet.drongo.psbt.PSBT;
|
||||
import com.sparrowwallet.drongo.uri.BitcoinURI;
|
||||
import com.sparrowwallet.sparrow.AppController;
|
||||
import com.sparrowwallet.sparrow.ur.ResultType;
|
||||
import com.sparrowwallet.sparrow.ur.UR;
|
||||
import com.sparrowwallet.sparrow.ur.URDecoder;
|
||||
import com.sparrowwallet.hummingbird.ResultType;
|
||||
import com.sparrowwallet.hummingbird.UR;
|
||||
import com.sparrowwallet.hummingbird.URDecoder;
|
||||
import javafx.application.Platform;
|
||||
import javafx.beans.value.ChangeListener;
|
||||
import javafx.beans.value.ObservableValue;
|
||||
|
|
|
@ -7,6 +7,7 @@ import com.sparrowwallet.drongo.protocol.*;
|
|||
import com.sparrowwallet.drongo.psbt.PSBT;
|
||||
import com.sparrowwallet.drongo.psbt.PSBTInput;
|
||||
import com.sparrowwallet.drongo.wallet.*;
|
||||
import com.sparrowwallet.hummingbird.UR;
|
||||
import com.sparrowwallet.sparrow.AppController;
|
||||
import com.sparrowwallet.sparrow.EventManager;
|
||||
import com.sparrowwallet.sparrow.control.*;
|
||||
|
@ -589,8 +590,12 @@ public class HeadersController extends TransactionFormController implements Init
|
|||
ToggleButton toggleButton = (ToggleButton)event.getSource();
|
||||
toggleButton.setSelected(false);
|
||||
|
||||
QRDisplayDialog qrDisplayDialog = new QRDisplayDialog(headersForm.getPsbt().serialize());
|
||||
qrDisplayDialog.show();
|
||||
try {
|
||||
QRDisplayDialog qrDisplayDialog = new QRDisplayDialog(UR.CRYPTO_PSBT_TYPE, headersForm.getPsbt().serialize());
|
||||
qrDisplayDialog.show();
|
||||
} catch(UR.URException e) {
|
||||
log.error("Error creating PSBT UR", e);
|
||||
}
|
||||
}
|
||||
|
||||
public void scanPSBT(ActionEvent event) {
|
||||
|
|
|
@ -1,153 +0,0 @@
|
|||
package com.sparrowwallet.sparrow.ur;
|
||||
|
||||
import java.io.ByteArrayOutputStream;
|
||||
import java.nio.ByteBuffer;
|
||||
import java.util.ArrayList;
|
||||
import java.util.Arrays;
|
||||
import java.util.List;
|
||||
import java.util.StringJoiner;
|
||||
import java.util.stream.Collectors;
|
||||
import java.util.stream.IntStream;
|
||||
import java.util.zip.CRC32;
|
||||
|
||||
/**
|
||||
* Ported from https://github.com/BlockchainCommons/URKit
|
||||
*/
|
||||
public class Bytewords {
|
||||
public static final String BYTEWORDS = "ableacidalsoapexaquaarchatomauntawayaxisbackbaldbarnbeltbetabiasbluebodybragbrewbulbbuzzcalmcashcatschefcityclawcodecolacookcostcruxcurlcuspcyandarkdatadaysdelidicedietdoordowndrawdropdrumdulldutyeacheasyechoedgeepicevenexamexiteyesfactfairfernfigsfilmfishfizzflapflewfluxfoxyfreefrogfuelfundgalagamegeargemsgiftgirlglowgoodgraygrimgurugushgyrohalfhanghardhawkheathelphighhillholyhopehornhutsicedideaidleinchinkyintoirisironitemjadejazzjoinjoltjowljudojugsjumpjunkjurykeepkenokeptkeyskickkilnkingkitekiwiknoblamblavalazyleaflegsliarlimplionlistlogoloudloveluaulucklungmainmanymathmazememomenumeowmildmintmissmonknailnavyneednewsnextnoonnotenumbobeyoboeomitonyxopenovalowlspaidpartpeckplaypluspoempoolposepuffpumapurrquadquizraceramprealredorichroadrockroofrubyruinrunsrustsafesagascarsetssilkskewslotsoapsolosongstubsurfswantacotasktaxitenttiedtimetinytoiltombtoystriptunatwinuglyundouniturgeuservastveryvetovialvibeviewvisavoidvowswallwandwarmwaspwavewaxywebswhatwhenwhizwolfworkyankyawnyellyogayurtzapszerozestzinczonezoom";
|
||||
private static final List<String> bytewordsList;
|
||||
private static final List<String> minimalBytewordsList;
|
||||
|
||||
static {
|
||||
bytewordsList = getBytewords();
|
||||
minimalBytewordsList = getMinimalBytewords();
|
||||
}
|
||||
|
||||
public enum Style {
|
||||
STANDARD, URI, MINIMAL
|
||||
}
|
||||
|
||||
public static int getEncodedLength(int length, Style style) {
|
||||
if(style == Style.STANDARD || style == Style.URI) {
|
||||
return length * 4 + (length - 1);
|
||||
}
|
||||
|
||||
return length * 2;
|
||||
}
|
||||
|
||||
public static String encode(byte[] data, Style style) {
|
||||
if(style == Style.STANDARD) {
|
||||
return encode(data, " ");
|
||||
}
|
||||
if(style == Style.URI) {
|
||||
return encode(data, "-");
|
||||
}
|
||||
|
||||
return encodeMinimal(data);
|
||||
}
|
||||
|
||||
public static byte[] decode(String encoded, Style style) {
|
||||
if(style == Style.STANDARD) {
|
||||
return decode(encoded, " ");
|
||||
}
|
||||
if(style == Style.URI) {
|
||||
return decode(encoded, "-");
|
||||
}
|
||||
|
||||
return decodeMinimal(encoded);
|
||||
}
|
||||
|
||||
private static String encode(byte[] data, String separator) {
|
||||
byte[] dataAndChecksum = appendChecksum(data);
|
||||
List<String> words = IntStream.range(0, dataAndChecksum.length).map(index -> dataAndChecksum[index] & 0xFF).mapToObj(Bytewords::getByteword).collect(Collectors.toList());
|
||||
StringJoiner joiner = new StringJoiner(separator);
|
||||
words.forEach(joiner::add);
|
||||
return joiner.toString();
|
||||
}
|
||||
|
||||
private static String encodeMinimal(byte[] data) {
|
||||
byte[] dataAndChecksum = appendChecksum(data);
|
||||
List<String> words = IntStream.range(0, dataAndChecksum.length).map(index -> dataAndChecksum[index] & 0xFF).mapToObj(Bytewords::getMinimalByteword).collect(Collectors.toList());
|
||||
StringBuilder buffer = new StringBuilder();
|
||||
words.forEach(buffer::append);
|
||||
return buffer.toString();
|
||||
}
|
||||
|
||||
private static byte[] decode(String encoded, String separator) {
|
||||
String[] words = encoded.split(separator);
|
||||
byte[] data = toByteArray(Arrays.stream(words).mapToInt(word -> getBytewords().indexOf(word)));
|
||||
return stripChecksum(data);
|
||||
}
|
||||
|
||||
private static byte[] decodeMinimal(String encoded) {
|
||||
List<String> words = splitStringBySize(encoded, 2);
|
||||
byte[] data = toByteArray(words.stream().mapToInt(word -> getMinimalBytewords().indexOf(word)));
|
||||
return stripChecksum(data);
|
||||
}
|
||||
|
||||
private static byte[] appendChecksum(byte[] data) {
|
||||
CRC32 crc = new CRC32();
|
||||
crc.update(data);
|
||||
|
||||
ByteBuffer checksum = ByteBuffer.allocate(Long.BYTES);
|
||||
checksum.putLong(crc.getValue());
|
||||
|
||||
byte[] result = new byte[data.length + 4];
|
||||
System.arraycopy(data, 0, result, 0, data.length);
|
||||
System.arraycopy(checksum.array(), 4, result, data.length, 4);
|
||||
|
||||
return result;
|
||||
}
|
||||
|
||||
private static byte[] stripChecksum(byte[] dataAndChecksum) {
|
||||
byte[] data = Arrays.copyOfRange(dataAndChecksum, 0, dataAndChecksum.length - 4);
|
||||
byte[] checksum = Arrays.copyOfRange(dataAndChecksum, dataAndChecksum.length - 4, dataAndChecksum.length);
|
||||
|
||||
CRC32 crc = new CRC32();
|
||||
crc.update(data);
|
||||
|
||||
ByteBuffer calculedChecksum = ByteBuffer.allocate(Long.BYTES);
|
||||
calculedChecksum.putLong(crc.getValue());
|
||||
if(!Arrays.equals(Arrays.copyOfRange(calculedChecksum.array(), 4, 8), checksum)) {
|
||||
throw new InvalidChecksumException("Invalid checksum");
|
||||
}
|
||||
|
||||
return data;
|
||||
}
|
||||
|
||||
private static String getByteword(int dataByte) {
|
||||
return bytewordsList.get(dataByte);
|
||||
}
|
||||
|
||||
private static String getMinimalByteword(int dataByte) {
|
||||
return minimalBytewordsList.get(dataByte);
|
||||
}
|
||||
|
||||
private static List<String> getBytewords() {
|
||||
return IntStream.range(0, 256).mapToObj(i -> BYTEWORDS.substring(i * 4, (i * 4) + 4)).collect(Collectors.toList());
|
||||
}
|
||||
|
||||
private static List<String> getMinimalBytewords() {
|
||||
return IntStream.range(0, 256).mapToObj(i -> Character.toString(BYTEWORDS.charAt(i * 4)) + BYTEWORDS.charAt((i * 4) + 3)).collect(Collectors.toList());
|
||||
}
|
||||
|
||||
public static byte[] toByteArray(IntStream stream) {
|
||||
return stream.collect(ByteArrayOutputStream::new, (baos, i) -> baos.write((byte) i),
|
||||
(baos1, baos2) -> baos1.write(baos2.toByteArray(), 0, baos2.size()))
|
||||
.toByteArray();
|
||||
}
|
||||
|
||||
private static List<String> splitStringBySize(String str, int size) {
|
||||
List<String> split = new ArrayList<>();
|
||||
for(int i = 0; i < str.length() / size; i++) {
|
||||
split.add(str.substring(i * size, Math.min((i + 1) * size, str.length())));
|
||||
}
|
||||
return split;
|
||||
}
|
||||
|
||||
public static class InvalidChecksumException extends RuntimeException {
|
||||
public InvalidChecksumException(String message) {
|
||||
super(message);
|
||||
}
|
||||
}
|
||||
}
|
|
@ -1,5 +0,0 @@
|
|||
package com.sparrowwallet.sparrow.ur;
|
||||
|
||||
public enum ResultType {
|
||||
SUCCESS, FAILURE;
|
||||
}
|
|
@ -1,137 +0,0 @@
|
|||
package com.sparrowwallet.sparrow.ur;
|
||||
|
||||
import co.nstant.in.cbor.CborBuilder;
|
||||
import co.nstant.in.cbor.CborDecoder;
|
||||
import co.nstant.in.cbor.CborEncoder;
|
||||
import co.nstant.in.cbor.CborException;
|
||||
import co.nstant.in.cbor.model.ByteString;
|
||||
import co.nstant.in.cbor.model.DataItem;
|
||||
|
||||
import java.io.ByteArrayInputStream;
|
||||
import java.io.ByteArrayOutputStream;
|
||||
import java.util.Arrays;
|
||||
import java.util.List;
|
||||
import java.util.Objects;
|
||||
|
||||
/**
|
||||
* Ported from https://github.com/BlockchainCommons/URKit
|
||||
*/
|
||||
public class UR {
|
||||
public static final String UR_PREFIX = "ur";
|
||||
public static final String BYTES_TYPE = "bytes";
|
||||
public static final String CRYPTO_PSBT_TYPE = "crypto-psbt";
|
||||
|
||||
private final String type;
|
||||
private final byte[] data;
|
||||
|
||||
public UR(String type, byte[] data) throws InvalidTypeException {
|
||||
if(!isURType(type)) {
|
||||
throw new InvalidTypeException("Invalid UR type: " + type);
|
||||
}
|
||||
|
||||
this.type = type;
|
||||
this.data = data;
|
||||
}
|
||||
|
||||
public String getType() {
|
||||
return type;
|
||||
}
|
||||
|
||||
public byte[] getCbor() {
|
||||
return data;
|
||||
}
|
||||
|
||||
public byte[] toBytes() throws InvalidTypeException, CborException {
|
||||
if(!BYTES_TYPE.equals(getType())) {
|
||||
throw new InvalidTypeException("Not a " + BYTES_TYPE + " type");
|
||||
}
|
||||
|
||||
ByteArrayInputStream bais = new ByteArrayInputStream(getCbor());
|
||||
List<DataItem> dataItems = new CborDecoder(bais).decode();
|
||||
return ((ByteString)dataItems.get(0)).getBytes();
|
||||
}
|
||||
|
||||
public static boolean isURType(String type) {
|
||||
for(char c : type.toCharArray()) {
|
||||
if('a' <= c && c <= 'z') {
|
||||
return true;
|
||||
}
|
||||
if('0' <= c && c <= '9') {
|
||||
return true;
|
||||
}
|
||||
if(c == '-') {
|
||||
return true;
|
||||
}
|
||||
}
|
||||
|
||||
return false;
|
||||
}
|
||||
|
||||
public static UR fromBytes(byte[] data) {
|
||||
try {
|
||||
ByteArrayOutputStream baos = new ByteArrayOutputStream();
|
||||
new CborEncoder(baos).encode(new CborBuilder()
|
||||
.add(data)
|
||||
.build());
|
||||
byte[] cbor = baos.toByteArray();
|
||||
|
||||
return new UR("bytes", cbor);
|
||||
} catch(InvalidTypeException | CborException e) {
|
||||
return null;
|
||||
}
|
||||
}
|
||||
|
||||
public String toString() {
|
||||
return UREncoder.encode(this);
|
||||
}
|
||||
|
||||
@Override
|
||||
public boolean equals(Object o) {
|
||||
if(this == o) {
|
||||
return true;
|
||||
}
|
||||
if(o == null || getClass() != o.getClass()) {
|
||||
return false;
|
||||
}
|
||||
UR ur = (UR) o;
|
||||
return type.equals(ur.type) &&
|
||||
Arrays.equals(data, ur.data);
|
||||
}
|
||||
|
||||
@Override
|
||||
public int hashCode() {
|
||||
int result = Objects.hash(type);
|
||||
result = 31 * result + Arrays.hashCode(data);
|
||||
return result;
|
||||
}
|
||||
|
||||
public static class URException extends Exception {
|
||||
public URException(String message) {
|
||||
super(message);
|
||||
}
|
||||
}
|
||||
|
||||
public static class InvalidTypeException extends URException {
|
||||
public InvalidTypeException(String message) {
|
||||
super(message);
|
||||
}
|
||||
}
|
||||
|
||||
public static class InvalidSchemeException extends URException {
|
||||
public InvalidSchemeException(String message) {
|
||||
super(message);
|
||||
}
|
||||
}
|
||||
|
||||
public static class InvalidPathLengthException extends URException {
|
||||
public InvalidPathLengthException(String message) {
|
||||
super(message);
|
||||
}
|
||||
}
|
||||
|
||||
public static class InvalidSequenceComponentException extends URException {
|
||||
public InvalidSequenceComponentException(String message) {
|
||||
super(message);
|
||||
}
|
||||
}
|
||||
}
|
|
@ -1,191 +0,0 @@
|
|||
package com.sparrowwallet.sparrow.ur;
|
||||
|
||||
import co.nstant.in.cbor.CborException;
|
||||
import com.sparrowwallet.sparrow.ur.fountain.FountainDecoder;
|
||||
import com.sparrowwallet.sparrow.ur.fountain.FountainEncoder;
|
||||
|
||||
import java.util.Arrays;
|
||||
import java.util.Set;
|
||||
import java.util.regex.Matcher;
|
||||
import java.util.regex.Pattern;
|
||||
|
||||
/**
|
||||
* Ported from https://github.com/BlockchainCommons/URKit
|
||||
*/
|
||||
public class URDecoder {
|
||||
private static final Pattern SEQUENCE_COMPONENT_PATTERN = Pattern.compile("(\\d+)-(\\d+)");
|
||||
|
||||
private final FountainDecoder fountainDecoder;
|
||||
|
||||
private String expectedType;
|
||||
private Result result;
|
||||
|
||||
public URDecoder() {
|
||||
this.fountainDecoder = new FountainDecoder();
|
||||
}
|
||||
|
||||
public int getExpectedPartCount() {
|
||||
return fountainDecoder.getExpectedPartCount();
|
||||
}
|
||||
|
||||
public Set<Integer> getReceivedPartIndexes() {
|
||||
return fountainDecoder.getRecievedPartIndexes();
|
||||
}
|
||||
|
||||
public Set<Integer> getLastPartIndexes() {
|
||||
return fountainDecoder.getLastPartIndexes();
|
||||
}
|
||||
|
||||
public int getProcessedPartsCount() {
|
||||
return fountainDecoder.getProcessedPartsCount();
|
||||
}
|
||||
|
||||
public double getEstimatedPercentComplete() {
|
||||
return fountainDecoder.getEstimatedPercentComplete();
|
||||
}
|
||||
|
||||
public Result getResult() {
|
||||
return result;
|
||||
}
|
||||
|
||||
public static UR decode(String string) throws UR.URException {
|
||||
ParsedURString parsedURString = parse(string);
|
||||
|
||||
if(parsedURString.components.length < 1) {
|
||||
throw new UR.InvalidPathLengthException("Invalid path length");
|
||||
}
|
||||
|
||||
String body = parsedURString.components[0];
|
||||
return decode(parsedURString.type, body);
|
||||
}
|
||||
|
||||
public static UR decode(String type, String body) throws UR.InvalidTypeException {
|
||||
byte[] cbor = Bytewords.decode(body, Bytewords.Style.MINIMAL);
|
||||
return new UR(type, cbor);
|
||||
}
|
||||
|
||||
public boolean receivePart(String string) {
|
||||
try {
|
||||
// Don't process the part if we're already done
|
||||
if(getResult() != null) {
|
||||
return false;
|
||||
}
|
||||
|
||||
// Don't continue if this part doesn't validate
|
||||
ParsedURString parsedURString = parse(string);
|
||||
if(!validatePart(parsedURString.type)) {
|
||||
return false;
|
||||
}
|
||||
|
||||
// If this is a single-part UR then we're done
|
||||
if(parsedURString.components.length == 1) {
|
||||
String body = parsedURString.components[0];
|
||||
result = new Result(ResultType.SUCCESS, decode(parsedURString.type, body), null);
|
||||
return true;
|
||||
}
|
||||
|
||||
// Multi-part URs must have two path components: seq/fragment
|
||||
if(parsedURString.components.length != 2) {
|
||||
throw new UR.InvalidPathLengthException("Invalid path length");
|
||||
}
|
||||
|
||||
String seq = parsedURString.components[0];
|
||||
String fragment = parsedURString.components[1];
|
||||
|
||||
// Parse the sequence component and the fragment, and
|
||||
// make sure they agree.
|
||||
Matcher matcher = SEQUENCE_COMPONENT_PATTERN.matcher(seq);
|
||||
if(matcher.matches()) {
|
||||
int seqNum = Integer.parseInt(matcher.group(1));
|
||||
int seqLen = Integer.parseInt(matcher.group(2));
|
||||
|
||||
byte[] cbor = Bytewords.decode(fragment, Bytewords.Style.MINIMAL);
|
||||
FountainEncoder.Part part = FountainEncoder.Part.fromCborBytes(cbor);
|
||||
|
||||
if(seqNum != part.getSeqNum() || seqLen != part.getSeqLen()) {
|
||||
return false;
|
||||
}
|
||||
|
||||
if(!fountainDecoder.receivePart(part)) {
|
||||
return false;
|
||||
}
|
||||
|
||||
if(fountainDecoder.getResult() == null) {
|
||||
//Not done yet
|
||||
} else if(fountainDecoder.getResult().type == ResultType.SUCCESS) {
|
||||
result = new Result(ResultType.SUCCESS, new UR(parsedURString.type, fountainDecoder.getResult().data), null);
|
||||
} else if(fountainDecoder.getResult().type == ResultType.FAILURE) {
|
||||
result = new Result(ResultType.FAILURE, null, fountainDecoder.getResult().error);
|
||||
}
|
||||
|
||||
return true;
|
||||
} else {
|
||||
throw new UR.InvalidSequenceComponentException("Invalid sequence " + seq);
|
||||
}
|
||||
} catch(UR.URException | CborException e) {
|
||||
return false;
|
||||
}
|
||||
}
|
||||
|
||||
private boolean validatePart(String type) {
|
||||
if(expectedType == null) {
|
||||
if(!UR.isURType(type)) {
|
||||
return false;
|
||||
}
|
||||
expectedType = type;
|
||||
} else {
|
||||
return expectedType.equals(type);
|
||||
}
|
||||
|
||||
return true;
|
||||
}
|
||||
|
||||
static ParsedURString parse(String string) throws UR.URException {
|
||||
// Don't consider case
|
||||
String lowercased = string.toLowerCase();
|
||||
|
||||
// Validate URI scheme
|
||||
if(!lowercased.startsWith("ur:")) {
|
||||
throw new UR.InvalidSchemeException("Invalid scheme");
|
||||
}
|
||||
String path = lowercased.substring(3);
|
||||
|
||||
// Split the remainder into path components
|
||||
String[] components = path.split("/");
|
||||
|
||||
// Make sure there are at least two path components
|
||||
if(components.length <= 1) {
|
||||
throw new UR.InvalidPathLengthException("Invalid path length");
|
||||
}
|
||||
|
||||
// Validate the type
|
||||
String type = components[0];
|
||||
if(!UR.isURType(type)) {
|
||||
throw new UR.InvalidTypeException("Invalid type: " + type);
|
||||
}
|
||||
|
||||
return new ParsedURString(type, Arrays.copyOfRange(components, 1, components.length));
|
||||
}
|
||||
|
||||
private static class ParsedURString {
|
||||
public final String type;
|
||||
public final String[] components;
|
||||
|
||||
public ParsedURString(String type, String[] components) {
|
||||
this.type = type;
|
||||
this.components = components;
|
||||
}
|
||||
}
|
||||
|
||||
public static class Result {
|
||||
public final ResultType type;
|
||||
public final UR ur;
|
||||
public final String error;
|
||||
|
||||
public Result(ResultType type, UR ur, String error) {
|
||||
this.type = type;
|
||||
this.ur = ur;
|
||||
this.error = error;
|
||||
}
|
||||
}
|
||||
}
|
|
@ -1,72 +0,0 @@
|
|||
package com.sparrowwallet.sparrow.ur;
|
||||
|
||||
import com.sparrowwallet.sparrow.ur.fountain.FountainEncoder;
|
||||
|
||||
import java.util.Arrays;
|
||||
import java.util.List;
|
||||
import java.util.StringJoiner;
|
||||
|
||||
/**
|
||||
* Ported from https://github.com/BlockchainCommons/URKit
|
||||
*/
|
||||
public class UREncoder {
|
||||
private final UR ur;
|
||||
private final FountainEncoder fountainEncoder;
|
||||
|
||||
public UREncoder(UR ur, int maxFragmentLen, int minFragmentLen, long firstSeqNum) {
|
||||
this.ur = ur;
|
||||
this.fountainEncoder = new FountainEncoder(ur.getCbor(), maxFragmentLen, minFragmentLen, firstSeqNum);
|
||||
}
|
||||
|
||||
public boolean isComplete() {
|
||||
return fountainEncoder.isComplete();
|
||||
}
|
||||
|
||||
public boolean isSinglePart() {
|
||||
return fountainEncoder.isSinglePart();
|
||||
}
|
||||
|
||||
public String nextPart() {
|
||||
FountainEncoder.Part part = fountainEncoder.nextPart();
|
||||
if(isSinglePart()) {
|
||||
return encode(ur);
|
||||
} else {
|
||||
return encodePart(ur.getType(), part);
|
||||
}
|
||||
}
|
||||
|
||||
public long getSeqNum() {
|
||||
return fountainEncoder.getSeqNum();
|
||||
}
|
||||
|
||||
public int getSeqLen() {
|
||||
return fountainEncoder.getSeqLen();
|
||||
}
|
||||
|
||||
public List<Integer> getPartIndexes() {
|
||||
return fountainEncoder.getPartIndexes();
|
||||
}
|
||||
|
||||
public static String encode(UR ur) {
|
||||
String encoded = Bytewords.encode(ur.getCbor(), Bytewords.Style.MINIMAL);
|
||||
return encodeUR(ur.getType(), encoded);
|
||||
}
|
||||
|
||||
private static String encodeUR(String... pathComponents) {
|
||||
return encodeURI(UR.UR_PREFIX, pathComponents);
|
||||
}
|
||||
|
||||
private static String encodeURI(String scheme, String... pathComponents) {
|
||||
StringJoiner joiner = new StringJoiner("/");
|
||||
Arrays.stream(pathComponents).forEach(joiner::add);
|
||||
String path = joiner.toString();
|
||||
|
||||
return scheme + ":" + path;
|
||||
}
|
||||
|
||||
private static String encodePart(String type, FountainEncoder.Part part) {
|
||||
String seq = part.getSeqNum() + "-" + part.getSeqLen();
|
||||
String body = Bytewords.encode(part.toCborBytes(), Bytewords.Style.MINIMAL);
|
||||
return encodeUR(type, seq, body);
|
||||
}
|
||||
}
|
|
@ -1,281 +0,0 @@
|
|||
package com.sparrowwallet.sparrow.ur.fountain;
|
||||
|
||||
import com.sparrowwallet.sparrow.ur.ResultType;
|
||||
import org.slf4j.Logger;
|
||||
import org.slf4j.LoggerFactory;
|
||||
|
||||
import java.io.ByteArrayOutputStream;
|
||||
import java.util.*;
|
||||
import java.util.stream.Collectors;
|
||||
import java.util.stream.IntStream;
|
||||
import java.util.zip.CRC32;
|
||||
|
||||
import static com.sparrowwallet.sparrow.ur.fountain.FountainUtils.chooseFragments;
|
||||
|
||||
/**
|
||||
* Ported from https://github.com/BlockchainCommons/URKit
|
||||
*/
|
||||
public class FountainDecoder {
|
||||
private static final Logger log = LoggerFactory.getLogger(FountainDecoder.class);
|
||||
|
||||
private final Set<Integer> recievedPartIndexes = new TreeSet<>();
|
||||
private Set<Integer> lastPartIndexes;
|
||||
private int processedPartsCount = 0;
|
||||
private Result result;
|
||||
private long checksum;
|
||||
|
||||
private Set<Integer> expectedPartIndexes;
|
||||
private int expectedFragmentLen;
|
||||
private int expectedMessageLen;
|
||||
private long expectedChecksum;
|
||||
|
||||
private final Map<List<Integer>, Part> simpleParts = new HashMap<>();
|
||||
private Map<List<Integer>, Part> mixedParts = new HashMap<>();
|
||||
private final List<Part> queuedParts = new ArrayList<>();
|
||||
|
||||
public int getExpectedPartCount() {
|
||||
return expectedPartIndexes.size();
|
||||
}
|
||||
|
||||
public Set<Integer> getRecievedPartIndexes() {
|
||||
return recievedPartIndexes;
|
||||
}
|
||||
|
||||
public Set<Integer> getLastPartIndexes() {
|
||||
return lastPartIndexes;
|
||||
}
|
||||
|
||||
public int getProcessedPartsCount() {
|
||||
return processedPartsCount;
|
||||
}
|
||||
|
||||
public double getEstimatedPercentComplete() {
|
||||
double estimatedInputParts = (double)getExpectedPartCount() * 1.75;
|
||||
return Math.min(0.99, (double)processedPartsCount / estimatedInputParts);
|
||||
}
|
||||
|
||||
public Result getResult() {
|
||||
return result;
|
||||
}
|
||||
|
||||
private static class Part {
|
||||
private final List<Integer> partIndexes;
|
||||
private final byte[] data;
|
||||
|
||||
private int getIndex() {
|
||||
return partIndexes.get(0);
|
||||
}
|
||||
|
||||
Part(FountainEncoder.Part part) {
|
||||
this.partIndexes = chooseFragments(part.getSeqNum(), part.getSeqLen(), part.getChecksum());
|
||||
this.data = part.getData();
|
||||
}
|
||||
|
||||
Part(List<Integer> indexes, byte[] data) {
|
||||
this.partIndexes = indexes;
|
||||
this.data = data;
|
||||
}
|
||||
|
||||
public boolean isSimple() {
|
||||
return partIndexes.size() == 1;
|
||||
}
|
||||
}
|
||||
|
||||
public static class Result {
|
||||
public final ResultType type;
|
||||
public final byte[] data;
|
||||
public final String error;
|
||||
|
||||
public Result(ResultType type, byte[] data, String error) {
|
||||
this.type = type;
|
||||
this.data = data;
|
||||
this.error = error;
|
||||
}
|
||||
}
|
||||
|
||||
public boolean receivePart(FountainEncoder.Part encoderPart) {
|
||||
// Don't process the part if we're already done
|
||||
if(result != null) {
|
||||
return false;
|
||||
}
|
||||
|
||||
// Don't continue if this part doesn't validate
|
||||
if(!validatePart(encoderPart)) {
|
||||
return false;
|
||||
}
|
||||
|
||||
// Add this part to the queue
|
||||
Part part = new Part(encoderPart);
|
||||
lastPartIndexes = new HashSet<>(part.partIndexes);
|
||||
enqueue(part);
|
||||
|
||||
// Process the queue until we're done or the queue is empty
|
||||
while(result == null && !queuedParts.isEmpty()) {
|
||||
processQueueItem();
|
||||
}
|
||||
|
||||
// Keep track of how many parts we've processed
|
||||
processedPartsCount += 1;
|
||||
//printPartEnd();
|
||||
|
||||
return true;
|
||||
}
|
||||
|
||||
private void enqueue(Part part) {
|
||||
queuedParts.add(part);
|
||||
}
|
||||
|
||||
private void printPartEnd() {
|
||||
int percent = (int)Math.round(getEstimatedPercentComplete() * 100);
|
||||
log.debug("processed: " + processedPartsCount + " expected: " + getExpectedPartCount() + " received: " + recievedPartIndexes.size() + " percent: " + percent + "%");
|
||||
}
|
||||
|
||||
private void printPart(Part part) {
|
||||
List<Integer> sorted = part.partIndexes.stream().sorted().collect(Collectors.toList());
|
||||
log.debug("part indexes: " + sorted);
|
||||
}
|
||||
|
||||
private void printState() {
|
||||
List<Integer> sortedReceived = recievedPartIndexes.stream().sorted().collect(Collectors.toList());
|
||||
List<List<Integer>> mixed = mixedParts.keySet().stream().map(list -> {
|
||||
list.sort(Comparator.naturalOrder());
|
||||
return list;
|
||||
}).collect(Collectors.toList());
|
||||
|
||||
log.debug("parts: " + getExpectedPartCount() + ", received: " + sortedReceived + ", mixed: " + mixed + ", queued: " + queuedParts.size() + ", result: " + result);
|
||||
}
|
||||
|
||||
private void processQueueItem() {
|
||||
Part part = queuedParts.remove(0);
|
||||
|
||||
//printPart(part);
|
||||
|
||||
if(part.isSimple()) {
|
||||
processSimplePart(part);
|
||||
} else {
|
||||
processMixedPart(part);
|
||||
}
|
||||
|
||||
//printState();
|
||||
}
|
||||
|
||||
private void reduceMixed(Part by) {
|
||||
// Reduce all the current mixed parts by the given part
|
||||
List<Part> reducedParts = mixedParts.values().stream().map(part -> reducePart(part, by)).collect(Collectors.toList());
|
||||
|
||||
// Collect all the remaining mixed parts
|
||||
Map<List<Integer>, Part> newMixed = new HashMap<>();
|
||||
reducedParts.forEach(reducedPart -> {
|
||||
// If this reduced part is now simple
|
||||
if(reducedPart.isSimple()) {
|
||||
// Add it to the queue
|
||||
enqueue(reducedPart);
|
||||
} else {
|
||||
// Otherwise, add it to the list of current mixed parts
|
||||
newMixed.put(reducedPart.partIndexes, reducedPart);
|
||||
}
|
||||
});
|
||||
|
||||
mixedParts = newMixed;
|
||||
}
|
||||
|
||||
// Reduce part `a` by part `b`
|
||||
private Part reducePart(Part a, Part b) {
|
||||
// If the fragments mixed into `b` are a strict (proper) subset of those in `a`...
|
||||
if(a.partIndexes.containsAll(b.partIndexes)) {
|
||||
// The new fragments in the revised part are `a` - `b`.
|
||||
List<Integer> newIndexes = new ArrayList<>(a.partIndexes);
|
||||
newIndexes.removeAll(b.partIndexes);
|
||||
|
||||
// The new data in the revised part are `a` XOR `b`
|
||||
byte[] newdata = FountainEncoder.xor(a.data, b.data);
|
||||
return new Part(newIndexes, newdata);
|
||||
} else {
|
||||
// `a` is not reducable by `b`, so return a
|
||||
return a;
|
||||
}
|
||||
}
|
||||
|
||||
private void processSimplePart(Part part) {
|
||||
// Don't process duplicate parts
|
||||
Integer fragmentIndex = part.partIndexes.get(0);
|
||||
if(recievedPartIndexes.contains(fragmentIndex)) {
|
||||
return;
|
||||
}
|
||||
|
||||
// Record this part
|
||||
simpleParts.put(part.partIndexes, part);
|
||||
recievedPartIndexes.add(fragmentIndex);
|
||||
|
||||
// If we've received all the parts
|
||||
if(recievedPartIndexes.equals(expectedPartIndexes)) {
|
||||
// Reassemble the message from its fragments
|
||||
List<Part> sortedParts = simpleParts.values().stream().sorted(Comparator.comparingInt(Part::getIndex)).collect(Collectors.toList());
|
||||
List<byte[]> fragments = sortedParts.stream().map(part1 -> part1.data).collect(Collectors.toList());
|
||||
byte[] message = joinFragments(fragments, expectedMessageLen);
|
||||
|
||||
// Verify the message checksum and note success or failure
|
||||
CRC32 crc32 = new CRC32();
|
||||
crc32.update(message);
|
||||
checksum = crc32.getValue();
|
||||
|
||||
if(checksum == expectedChecksum) {
|
||||
result = new Result(ResultType.SUCCESS, message, null);
|
||||
} else {
|
||||
result = new Result(ResultType.FAILURE, null, "Invalid checksum");
|
||||
}
|
||||
} else {
|
||||
// Reduce all the mixed parts by this part
|
||||
reduceMixed(part);
|
||||
}
|
||||
}
|
||||
|
||||
private void processMixedPart(Part part) {
|
||||
// Don't process duplicate parts
|
||||
if(mixedParts.containsKey(part.partIndexes)) {
|
||||
return;
|
||||
}
|
||||
|
||||
// Reduce this part by all the others
|
||||
List<Part> allParts = new ArrayList<>(simpleParts.values());
|
||||
allParts.addAll(mixedParts.values());
|
||||
Part p = allParts.stream().reduce(part, this::reducePart);
|
||||
|
||||
// If the part is now simple
|
||||
if(p.isSimple()) {
|
||||
// Add it to the queue
|
||||
enqueue(p);
|
||||
} else {
|
||||
// Reduce all the mixed parts by this one
|
||||
reduceMixed(p);
|
||||
// Record this new mixed part
|
||||
mixedParts.put(p.partIndexes, p);
|
||||
}
|
||||
}
|
||||
|
||||
private boolean validatePart(FountainEncoder.Part part) {
|
||||
// If this is the first part we've seen
|
||||
if(expectedPartIndexes == null) {
|
||||
// Record the things that all the other parts we see will have to match to be valid.
|
||||
expectedPartIndexes = IntStream.range(0, part.getSeqLen()).boxed().collect(Collectors.toSet());
|
||||
expectedMessageLen = part.getMessageLen();
|
||||
expectedChecksum = part.getChecksum();
|
||||
expectedFragmentLen = part.getData().length;
|
||||
|
||||
return true;
|
||||
} else {
|
||||
return getExpectedPartCount() == part.getSeqLen() && expectedMessageLen == part.getMessageLen() && expectedChecksum == part.getChecksum() && expectedFragmentLen == part.getData().length;
|
||||
}
|
||||
}
|
||||
|
||||
static byte[] joinFragments(List<byte[]> fragments, int messageLen) {
|
||||
ByteArrayOutputStream baos = new ByteArrayOutputStream();
|
||||
fragments.forEach(baos::writeBytes);
|
||||
byte[] message = baos.toByteArray();
|
||||
|
||||
byte[] unpaddedMessage = new byte[messageLen];
|
||||
System.arraycopy(message, 0, unpaddedMessage, 0, messageLen);
|
||||
|
||||
return unpaddedMessage;
|
||||
}
|
||||
}
|
|
@ -1,185 +0,0 @@
|
|||
package com.sparrowwallet.sparrow.ur.fountain;
|
||||
|
||||
import co.nstant.in.cbor.CborBuilder;
|
||||
import co.nstant.in.cbor.CborDecoder;
|
||||
import co.nstant.in.cbor.CborEncoder;
|
||||
import co.nstant.in.cbor.CborException;
|
||||
import co.nstant.in.cbor.model.Array;
|
||||
import co.nstant.in.cbor.model.ByteString;
|
||||
import co.nstant.in.cbor.model.DataItem;
|
||||
import co.nstant.in.cbor.model.UnsignedInteger;
|
||||
|
||||
import java.io.ByteArrayInputStream;
|
||||
import java.io.ByteArrayOutputStream;
|
||||
import java.util.ArrayList;
|
||||
import java.util.Arrays;
|
||||
import java.util.List;
|
||||
import java.util.zip.CRC32;
|
||||
|
||||
import static com.sparrowwallet.sparrow.ur.fountain.FountainUtils.chooseFragments;
|
||||
|
||||
/**
|
||||
* Ported from https://github.com/BlockchainCommons/URKit
|
||||
*/
|
||||
public class FountainEncoder {
|
||||
private final int messageLen;
|
||||
private final long checksum;
|
||||
private final int fragmentLen;
|
||||
private final List<byte[]> fragments;
|
||||
private final int seqLen;
|
||||
private List<Integer> partIndexes;
|
||||
private long seqNum;
|
||||
|
||||
public FountainEncoder(byte[] message, int maxFragmentLen, int minFragmentLen, long firstSeqNum) {
|
||||
if(message.length >= Integer.MAX_VALUE) {
|
||||
throw new IllegalArgumentException("Message too long");
|
||||
}
|
||||
|
||||
this.messageLen = message.length;
|
||||
|
||||
CRC32 crc32 = new CRC32();
|
||||
crc32.update(message);
|
||||
this.checksum = crc32.getValue();
|
||||
|
||||
this.fragmentLen = findNominalFragmentLength(messageLen, minFragmentLen, maxFragmentLen);
|
||||
this.fragments = partitionMessage(message, fragmentLen);
|
||||
this.seqLen = fragments.size();
|
||||
this.seqNum = firstSeqNum;
|
||||
}
|
||||
|
||||
public Part nextPart() {
|
||||
seqNum += 1;
|
||||
partIndexes = chooseFragments(seqNum, seqLen, checksum);
|
||||
byte[] mixed = mix(partIndexes);
|
||||
return new Part(seqNum, seqLen, messageLen, checksum, mixed);
|
||||
}
|
||||
|
||||
private byte[] mix(List<Integer> partIndexes) {
|
||||
return partIndexes.stream().reduce(new byte[fragmentLen], (result, index) -> xor(fragments.get(index), result), FountainEncoder::xor);
|
||||
}
|
||||
|
||||
public static byte[] xor(byte[] a, byte[] b) {
|
||||
byte[] result = new byte[a.length];
|
||||
for (int i = 0; i < result.length; i++) {
|
||||
result[i] = (byte) (((int) a[i]) ^ ((int) b[i]));
|
||||
}
|
||||
|
||||
return result;
|
||||
}
|
||||
|
||||
public boolean isComplete() {
|
||||
return seqNum >= seqLen;
|
||||
}
|
||||
|
||||
public boolean isSinglePart() {
|
||||
return seqLen == 1;
|
||||
}
|
||||
|
||||
public long getSeqNum() {
|
||||
return seqNum;
|
||||
}
|
||||
|
||||
public int getSeqLen() {
|
||||
return seqLen;
|
||||
}
|
||||
|
||||
public List<Integer> getPartIndexes() {
|
||||
return partIndexes;
|
||||
}
|
||||
|
||||
static List<byte[]> partitionMessage(byte[] message, int fragmentLen) {
|
||||
int fragmentCount = (int)Math.ceil(message.length / (double)fragmentLen);
|
||||
List<byte[]> fragments = new ArrayList<>();
|
||||
|
||||
int start = 0;
|
||||
for(int i = 0; i < fragmentCount; i++) {
|
||||
fragments.add(Arrays.copyOfRange(message, start, start + fragmentLen));
|
||||
start += fragmentLen;
|
||||
}
|
||||
|
||||
return fragments;
|
||||
}
|
||||
|
||||
static int findNominalFragmentLength(int messageLen, int minFragmentLen, int maxFragmentLen) {
|
||||
int maxFragmentCount = messageLen / minFragmentLen;
|
||||
int fragmentLen = 0;
|
||||
for(int fragmentCount = 1; fragmentCount <= maxFragmentCount; fragmentCount++) {
|
||||
fragmentLen = (int)Math.ceil((double)messageLen / (double)fragmentCount);
|
||||
if(fragmentLen <= maxFragmentLen) {
|
||||
break;
|
||||
}
|
||||
}
|
||||
|
||||
return fragmentLen;
|
||||
}
|
||||
|
||||
public static class Part {
|
||||
private final long seqNum;
|
||||
private final int seqLen;
|
||||
private final int messageLen;
|
||||
private final long checksum;
|
||||
private final byte[] data;
|
||||
|
||||
public Part(long seqNum, int seqLen, int messageLen, long checksum, byte[] data) {
|
||||
this.seqNum = seqNum;
|
||||
this.seqLen = seqLen;
|
||||
this.messageLen = messageLen;
|
||||
this.checksum = checksum;
|
||||
this.data = data;
|
||||
}
|
||||
|
||||
public long getSeqNum() {
|
||||
return seqNum;
|
||||
}
|
||||
|
||||
public int getSeqLen() {
|
||||
return seqLen;
|
||||
}
|
||||
|
||||
public int getMessageLen() {
|
||||
return messageLen;
|
||||
}
|
||||
|
||||
public long getChecksum() {
|
||||
return checksum;
|
||||
}
|
||||
|
||||
public byte[] getData() {
|
||||
return data;
|
||||
}
|
||||
|
||||
public byte[] toCborBytes() {
|
||||
try {
|
||||
ByteArrayOutputStream baos = new ByteArrayOutputStream();
|
||||
new CborEncoder(baos).encode(new CborBuilder()
|
||||
.addArray()
|
||||
.add(new UnsignedInteger(seqNum))
|
||||
.add(new UnsignedInteger(seqLen))
|
||||
.add(new UnsignedInteger(messageLen))
|
||||
.add(new UnsignedInteger(checksum))
|
||||
.add(data)
|
||||
.end()
|
||||
.build());
|
||||
|
||||
return baos.toByteArray();
|
||||
} catch(Exception e) {
|
||||
throw new RuntimeException(e);
|
||||
}
|
||||
}
|
||||
|
||||
public static Part fromCborBytes(byte[] cborData) throws CborException {
|
||||
ByteArrayInputStream bais = new ByteArrayInputStream(cborData);
|
||||
List<DataItem> arrayDataItems = new CborDecoder(bais).decode();
|
||||
Array array = (Array)arrayDataItems.get(0);
|
||||
List<DataItem> dataItems = array.getDataItems();
|
||||
|
||||
UnsignedInteger seqNum = (UnsignedInteger)dataItems.get(0);
|
||||
UnsignedInteger seqLen = (UnsignedInteger)dataItems.get(1);
|
||||
UnsignedInteger messageLen = (UnsignedInteger)dataItems.get(2);
|
||||
UnsignedInteger checksum = (UnsignedInteger)dataItems.get(3);
|
||||
ByteString data = (ByteString)dataItems.get(4);
|
||||
|
||||
return new Part(seqNum.getValue().longValue(), seqLen.getValue().intValue(), messageLen.getValue().intValue(), checksum.getValue().longValue(), data.getBytes());
|
||||
}
|
||||
}
|
||||
}
|
|
@ -1,50 +0,0 @@
|
|||
package com.sparrowwallet.sparrow.ur.fountain;
|
||||
|
||||
import java.nio.ByteBuffer;
|
||||
import java.util.ArrayList;
|
||||
import java.util.List;
|
||||
import java.util.stream.Collectors;
|
||||
import java.util.stream.IntStream;
|
||||
|
||||
/**
|
||||
* Ported from https://github.com/BlockchainCommons/URKit
|
||||
*/
|
||||
public class FountainUtils {
|
||||
static List<Integer> chooseFragments(long seqNum, int seqLen, long checkSum) {
|
||||
// The first `seqLen` parts are the "pure" fragments, not mixed with any
|
||||
// others. This means that if you only generate the first `seqLen` parts,
|
||||
// then you have all the parts you need to decode the message.
|
||||
if(seqNum <= seqLen) {
|
||||
return List.of((int)seqNum - 1);
|
||||
} else {
|
||||
ByteBuffer buffer = ByteBuffer.allocate(Integer.BYTES * 2);
|
||||
buffer.putInt((int)(seqNum));
|
||||
buffer.putInt((int)(checkSum));
|
||||
|
||||
RandomXoshiro256StarStar rng = new RandomXoshiro256StarStar(buffer.array());
|
||||
int degree = chooseDegree(seqLen, rng);
|
||||
List<Integer> indexes = IntStream.range(0, seqLen).boxed().collect(Collectors.toList());
|
||||
List<Integer> shuffledIndexes = shuffled(indexes, rng);
|
||||
return new ArrayList<>(shuffledIndexes.subList(0, degree));
|
||||
}
|
||||
}
|
||||
|
||||
static int chooseDegree(int seqLen, RandomXoshiro256StarStar rng) {
|
||||
List<Double> degreeProbabilties = IntStream.range(1, seqLen + 1).mapToObj(i -> 1 / (double)i).collect(Collectors.toList());
|
||||
RandomSampler randomSampler = new RandomSampler(degreeProbabilties);
|
||||
return randomSampler.next(rng) + 1;
|
||||
}
|
||||
|
||||
static List<Integer> shuffled(List<Integer> indexes, RandomXoshiro256StarStar rng) {
|
||||
List<Integer> remaining = new ArrayList<>(indexes);
|
||||
List<Integer> shuffled = new ArrayList<>(indexes.size());
|
||||
|
||||
while(!remaining.isEmpty()) {
|
||||
int index = rng.nextInt(0, remaining.size());
|
||||
Integer item = remaining.remove(index);
|
||||
shuffled.add(item);
|
||||
}
|
||||
|
||||
return shuffled;
|
||||
}
|
||||
}
|
|
@ -1,84 +0,0 @@
|
|||
package com.sparrowwallet.sparrow.ur.fountain;
|
||||
|
||||
import java.util.ArrayList;
|
||||
import java.util.List;
|
||||
import java.util.Random;
|
||||
import java.util.stream.Collectors;
|
||||
|
||||
/**
|
||||
* Random-number sampling using the Walker-Vose alias method,
|
||||
* as described by Keith Schwarz (2011)
|
||||
* http://www.keithschwarz.com/darts-dice-coins
|
||||
*
|
||||
* Based on C implementation:
|
||||
* https://jugit.fz-juelich.de/mlz/ransampl
|
||||
*
|
||||
* Ported from https://github.com/BlockchainCommons/URKit
|
||||
*/
|
||||
public class RandomSampler {
|
||||
/* The probability and alias tables. */
|
||||
private final double[] probs;
|
||||
private final int[] aliases;
|
||||
|
||||
public RandomSampler(List<Double> probabilities) {
|
||||
if(probabilities.stream().anyMatch(prob -> prob < 0)) {
|
||||
throw new IllegalArgumentException("Probabilties must be > 0");
|
||||
}
|
||||
|
||||
// Normalize given probabilities
|
||||
double sum = probabilities.stream().reduce(0d, Double::sum);
|
||||
|
||||
int n = probabilities.size();
|
||||
List<Double> P = probabilities.stream().map(prob -> prob * (double)n / sum).collect(Collectors.toList());
|
||||
|
||||
List<Integer> S = new ArrayList<>();
|
||||
List<Integer> L = new ArrayList<>();
|
||||
|
||||
// Set separate index lists for small and large probabilities:
|
||||
for(int i = n - 1; i >= 0; i--) {
|
||||
// at variance from Schwarz, we reverse the index order
|
||||
if(P.get(i) < 1d) {
|
||||
S.add(i);
|
||||
} else {
|
||||
L.add(i);
|
||||
}
|
||||
}
|
||||
|
||||
// Work through index lists
|
||||
double[] probs = new double[n];
|
||||
int[] aliases = new int[n];
|
||||
|
||||
while(!S.isEmpty() && !L.isEmpty()) {
|
||||
int a = S.remove(S.size() - 1);
|
||||
int g = L.remove(L.size() - 1);
|
||||
probs[a] = P.get(a);
|
||||
aliases[a] = g;
|
||||
P.set(g, P.get(g) + P.get(a) - 1);
|
||||
if(P.get(g) < 1) {
|
||||
S.add(g);
|
||||
} else {
|
||||
L.add(g);
|
||||
}
|
||||
}
|
||||
|
||||
while(!L.isEmpty()) {
|
||||
probs[L.remove(L.size() - 1)] = 1;
|
||||
}
|
||||
|
||||
while(!S.isEmpty()) {
|
||||
// can only happen through numeric instability
|
||||
probs[S.remove(S.size() - 1)] = 1;
|
||||
}
|
||||
|
||||
this.probs = probs;
|
||||
this.aliases = aliases;
|
||||
}
|
||||
|
||||
public int next(Random random) {
|
||||
double r1 = random.nextDouble();
|
||||
double r2 = random.nextDouble();
|
||||
int n = probs.length;
|
||||
int i = (int)((double)n * r1);
|
||||
return r2 < probs[i] ? i : aliases[i];
|
||||
}
|
||||
}
|
|
@ -1,241 +0,0 @@
|
|||
package com.sparrowwallet.sparrow.ur.fountain;
|
||||
|
||||
/*
|
||||
* To the extent possible under law, the author has dedicated all copyright
|
||||
* and related and neighboring rights to this software to the public domain
|
||||
* worldwide. This software is distributed without any warranty.
|
||||
*
|
||||
* See <http://creativecommons.org/publicdomain/zero/1.0/>
|
||||
*/
|
||||
|
||||
import com.sparrowwallet.drongo.protocol.Sha256Hash;
|
||||
|
||||
import java.nio.charset.StandardCharsets;
|
||||
import java.util.Random;
|
||||
import java.util.concurrent.atomic.AtomicLong;
|
||||
|
||||
/**
|
||||
* Implementation of Random based on the xoshiro256** RNG. No-dependencies
|
||||
* Java port of the <a href="http://xoshiro.di.unimi.it/xoshiro256starstar.c">original C code</a>,
|
||||
* which is public domain. This Java port is similarly dedicated to the public
|
||||
* domain.
|
||||
* <p>
|
||||
* Individual instances are not thread-safe. Each thread must have its own
|
||||
* instance which is not shared.
|
||||
*
|
||||
* @author David Blackman and Sebastiano Vigna <vigna@acm.org> (original C code)
|
||||
* @author Una Thompson <una@unascribed.com> (Java port)
|
||||
* @see <a href="http://xoshiro.di.unimi.it/">http://xoshiro.di.unimi.it/</a>
|
||||
*/
|
||||
public class RandomXoshiro256StarStar extends Random {
|
||||
private static final long serialVersionUID = -2837799889588687855L;
|
||||
|
||||
private static final AtomicLong uniq = new AtomicLong(System.nanoTime());
|
||||
|
||||
private static final long nextUniq() {
|
||||
return splitmix64_2(uniq.addAndGet(SPLITMIX1_MAGIC));
|
||||
}
|
||||
|
||||
private long seed;
|
||||
|
||||
public RandomXoshiro256StarStar() {
|
||||
this(System.nanoTime() ^ nextUniq());
|
||||
}
|
||||
|
||||
public RandomXoshiro256StarStar(long seed) {
|
||||
super(seed);
|
||||
// super will call setSeed
|
||||
}
|
||||
|
||||
public RandomXoshiro256StarStar(String seed) {
|
||||
this(seed.getBytes(StandardCharsets.UTF_8));
|
||||
}
|
||||
|
||||
public RandomXoshiro256StarStar(byte[] seed) {
|
||||
this(Sha256Hash.of(seed));
|
||||
}
|
||||
|
||||
public RandomXoshiro256StarStar(Sha256Hash digest) {
|
||||
long[] s = new long[4];
|
||||
byte[] digestBytes = digest.getBytes();
|
||||
|
||||
for(int i = 0; i < 4; i++) {
|
||||
int o = i * 8;
|
||||
long v = 0L;
|
||||
for(int n = 0; n < 8; n++) {
|
||||
v = v << 8;
|
||||
v |= digestBytes[o + n] & 0xFF;
|
||||
}
|
||||
s[i] = v;
|
||||
}
|
||||
|
||||
setState(s[0], s[1], s[2], s[3]);
|
||||
}
|
||||
|
||||
public RandomXoshiro256StarStar(long s1, long s2, long s3, long s4) {
|
||||
setState(s1, s2, s3, s4);
|
||||
}
|
||||
|
||||
// used to "stretch" seeds into a full 256-bit state; also makes
|
||||
// it safe to pass in zero as a seed
|
||||
////
|
||||
// what generator is used here is unimportant, as long as it's
|
||||
// from a different family, but splitmix64 happens to be an
|
||||
// incredibly simple high-quality generator of a completely
|
||||
// different family (and is recommended by the xoshiro authors)
|
||||
|
||||
private static final long SPLITMIX1_MAGIC = 0x9E3779B97F4A7C15L;
|
||||
|
||||
private static long splitmix64_1(long x) {
|
||||
return (x + SPLITMIX1_MAGIC);
|
||||
}
|
||||
|
||||
private static long splitmix64_2(long z) {
|
||||
z = (z ^ (z >> 30)) * 0xBF58476D1CE4E5B9L;
|
||||
z = (z ^ (z >> 27)) * 0x94D049BB133111EBL;
|
||||
return z ^ (z >> 31);
|
||||
}
|
||||
|
||||
@Override
|
||||
public void setSeed(long seed) {
|
||||
this.seed = seed;
|
||||
|
||||
// update haveNextNextGaussian flag in super
|
||||
super.setSeed(seed);
|
||||
long sms = splitmix64_1(seed);
|
||||
s0 = splitmix64_2(sms);
|
||||
sms = splitmix64_1(sms);
|
||||
s1 = splitmix64_2(sms);
|
||||
sms = splitmix64_1(sms);
|
||||
s2 = splitmix64_2(sms);
|
||||
sms = splitmix64_1(sms);
|
||||
s3 = splitmix64_2(sms);
|
||||
}
|
||||
|
||||
public void setState(long s0, long s1, long s2, long s4) {
|
||||
if(s0 == 0 && s1 == 0 && s2 == 0 && s4 == 0) {
|
||||
throw new IllegalArgumentException("xoshiro256** state cannot be all zeroes");
|
||||
}
|
||||
this.s0 = s0;
|
||||
this.s1 = s1;
|
||||
this.s2 = s2;
|
||||
this.s3 = s4;
|
||||
}
|
||||
|
||||
// not called, implemented instead of just throwing for completeness
|
||||
@Override
|
||||
protected int next(int bits) {
|
||||
return (int) (nextLong() & ((1L << bits) - 1));
|
||||
}
|
||||
|
||||
@Override
|
||||
public int nextInt() {
|
||||
return (int) nextLong();
|
||||
}
|
||||
|
||||
@Override
|
||||
public int nextInt(int bound) {
|
||||
return (int) nextLong(bound);
|
||||
}
|
||||
|
||||
public long nextLong(long bound) {
|
||||
if(bound <= 0) {
|
||||
throw new IllegalArgumentException("bound must be positive");
|
||||
}
|
||||
// clear sign bit for positive-only, modulo to bound
|
||||
return (nextLong() & Long.MAX_VALUE) % bound;
|
||||
}
|
||||
|
||||
@Override
|
||||
public double nextDouble() {
|
||||
return (nextLong() >>> 11) * 0x1.0P-53;
|
||||
}
|
||||
|
||||
@Override
|
||||
public float nextFloat() {
|
||||
return (nextLong() >>> 40) * 0x1.0P-24f;
|
||||
}
|
||||
|
||||
@Override
|
||||
public boolean nextBoolean() {
|
||||
return (nextLong() & 1) != 0;
|
||||
}
|
||||
|
||||
@Override
|
||||
public void nextBytes(byte[] buf) {
|
||||
nextBytes(buf, 0, buf.length);
|
||||
}
|
||||
|
||||
public void nextBytes(byte[] buf, int ofs, int len) {
|
||||
if(ofs < 0) {
|
||||
throw new ArrayIndexOutOfBoundsException("Offset " + ofs + " is negative");
|
||||
}
|
||||
if(ofs >= buf.length) {
|
||||
throw new ArrayIndexOutOfBoundsException("Offset " + ofs + " is greater than buffer length");
|
||||
}
|
||||
if(ofs + len > buf.length) {
|
||||
throw new ArrayIndexOutOfBoundsException("Length " + len + " with offset " + ofs + " is past end of buffer");
|
||||
}
|
||||
int j = 8;
|
||||
long l = 0;
|
||||
for(int i = ofs; i < ofs + len; i++) {
|
||||
if(j >= 8) {
|
||||
l = nextLong();
|
||||
j = 0;
|
||||
}
|
||||
buf[i] = (byte) (l & 0xFF);
|
||||
l = l >>> 8L;
|
||||
j++;
|
||||
}
|
||||
}
|
||||
|
||||
public void nextData(byte[] data) {
|
||||
for(int i = 0; i < data.length; i++) {
|
||||
data[i] = (byte)(nextInt(0, 256) & 0xFF);
|
||||
}
|
||||
}
|
||||
|
||||
public int nextInt(int lowerBound, int count) {
|
||||
double next = nextDouble();
|
||||
double dou = (next * count);
|
||||
return (int)(dou) + lowerBound;
|
||||
}
|
||||
|
||||
/* This is xoshiro256** 1.0, our all-purpose, rock-solid generator. It has
|
||||
excellent (sub-ns) speed, a state (256 bits) that is large enough for
|
||||
any parallel application, and it passes all tests we are aware of.
|
||||
|
||||
For generating just floating-point numbers, xoshiro256+ is even faster.
|
||||
|
||||
The state must be seeded so that it is not everywhere zero. If you have
|
||||
a 64-bit seed, we suggest to seed a splitmix64 generator and use its
|
||||
output to fill s. */
|
||||
|
||||
private static long rotl(long x, int k) {
|
||||
return (x << k) | (x >>> (64 - k));
|
||||
}
|
||||
|
||||
|
||||
private long s0;
|
||||
private long s1;
|
||||
private long s2;
|
||||
private long s3;
|
||||
|
||||
@Override
|
||||
public long nextLong() {
|
||||
long result_starstar = rotl(s1 * 5, 7) * 9;
|
||||
|
||||
long t = s1 << 17;
|
||||
|
||||
s2 ^= s0;
|
||||
s3 ^= s1;
|
||||
s1 ^= s2;
|
||||
s0 ^= s3;
|
||||
|
||||
s2 ^= t;
|
||||
|
||||
s3 = rotl(s3, 45);
|
||||
|
||||
return result_starstar;
|
||||
}
|
||||
}
|
|
@ -18,9 +18,9 @@ open module com.sparrowwallet.sparrow {
|
|||
requires simple.json.rpc.core;
|
||||
requires org.jetbrains.annotations;
|
||||
requires com.fasterxml.jackson.databind;
|
||||
requires cbor;
|
||||
requires webcam.capture;
|
||||
requires netlayer.jpms;
|
||||
requires hummingbird;
|
||||
requires centerdevice.nsmenufx;
|
||||
requires jcommander;
|
||||
requires slf4j.api;
|
||||
|
|
|
@ -1,24 +0,0 @@
|
|||
package com.sparrowwallet.sparrow.ur;
|
||||
|
||||
import com.sparrowwallet.drongo.Utils;
|
||||
import org.junit.Assert;
|
||||
import org.junit.Test;
|
||||
|
||||
public class BytewordsTest {
|
||||
@Test
|
||||
public void test() {
|
||||
byte[] data = Utils.hexToBytes("d9012ca20150c7098580125e2ab0981253468b2dbc5202d8641947da");
|
||||
String encoded = Bytewords.encode(data, Bytewords.Style.STANDARD);
|
||||
Assert.assertEquals("tuna acid draw oboe acid good slot axis limp lava brag holy door puff monk brag guru frog luau drop roof grim also trip idle chef fuel twin tied draw grim ramp", encoded);
|
||||
byte[] data2 = Bytewords.decode(encoded, Bytewords.Style.STANDARD);
|
||||
Assert.assertArrayEquals(data, data2);
|
||||
|
||||
encoded = Bytewords.encode(data, Bytewords.Style.URI);
|
||||
Assert.assertEquals("tuna-acid-draw-oboe-acid-good-slot-axis-limp-lava-brag-holy-door-puff-monk-brag-guru-frog-luau-drop-roof-grim-also-trip-idle-chef-fuel-twin-tied-draw-grim-ramp", encoded);
|
||||
|
||||
encoded = Bytewords.encode(data, Bytewords.Style.MINIMAL);
|
||||
Assert.assertEquals("taaddwoeadgdstaslplabghydrpfmkbggufgludprfgmaotpiecffltntddwgmrp", encoded);
|
||||
data2 = Bytewords.decode(encoded, Bytewords.Style.MINIMAL);
|
||||
Assert.assertArrayEquals(data, data2);
|
||||
}
|
||||
}
|
|
@ -1,107 +0,0 @@
|
|||
package com.sparrowwallet.sparrow.ur;
|
||||
|
||||
import co.nstant.in.cbor.CborBuilder;
|
||||
import co.nstant.in.cbor.CborEncoder;
|
||||
import com.sparrowwallet.drongo.Utils;
|
||||
import com.sparrowwallet.sparrow.ur.fountain.RandomXoshiro256StarStar;
|
||||
import org.junit.Assert;
|
||||
import org.junit.Test;
|
||||
|
||||
import java.io.ByteArrayOutputStream;
|
||||
import java.util.List;
|
||||
import java.util.stream.Collectors;
|
||||
import java.util.stream.IntStream;
|
||||
|
||||
public class URTest {
|
||||
@Test
|
||||
public void testSinglePartUR() {
|
||||
UR ur = makeMessageUR(50, "Wolf");
|
||||
String encoded = UREncoder.encode(ur);
|
||||
Assert.assertEquals("ur:bytes/hdeymejtswhhylkepmykhhtsytsnoyoyaxaedsuttydmmhhpktpmsrjtgwdpfnsboxgwlbaawzuefywkdplrsrjynbvygabwjldapfcsdwkbrkch", encoded);
|
||||
}
|
||||
|
||||
@Test
|
||||
public void testEncode() {
|
||||
UR ur = makeMessageUR(256, "Wolf");
|
||||
UREncoder urEncoder = new UREncoder(ur, 30, 10, 0);
|
||||
List<String> parts = IntStream.range(0, 20).mapToObj(i -> urEncoder.nextPart()).collect(Collectors.toList());
|
||||
String[] expectedParts = new String[] {
|
||||
"ur:bytes/1-9/lpadascfadaxcywenbpljkhdcahkadaemejtswhhylkepmykhhtsytsnoyoyaxaedsuttydmmhhpktpmsrjtdkgslpgh",
|
||||
"ur:bytes/2-9/lpaoascfadaxcywenbpljkhdcagwdpfnsboxgwlbaawzuefywkdplrsrjynbvygabwjldapfcsgmghhkhstlrdcxaefz",
|
||||
"ur:bytes/3-9/lpaxascfadaxcywenbpljkhdcahelbknlkuejnbadmssfhfrdpsbiegecpasvssovlgeykssjykklronvsjksopdzmol",
|
||||
"ur:bytes/4-9/lpaaascfadaxcywenbpljkhdcasotkhemthydawydtaxneurlkosgwcekonertkbrlwmplssjtammdplolsbrdzcrtas",
|
||||
"ur:bytes/5-9/lpahascfadaxcywenbpljkhdcatbbdfmssrkzmcwnezelennjpfzbgmuktrhtejscktelgfpdlrkfyfwdajldejokbwf",
|
||||
"ur:bytes/6-9/lpamascfadaxcywenbpljkhdcackjlhkhybssklbwefectpfnbbectrljectpavyrolkzczcpkmwidmwoxkilghdsowp",
|
||||
"ur:bytes/7-9/lpatascfadaxcywenbpljkhdcavszmwnjkwtclrtvaynhpahrtoxmwvwatmedibkaegdosftvandiodagdhthtrlnnhy",
|
||||
"ur:bytes/8-9/lpayascfadaxcywenbpljkhdcadmsponkkbbhgsoltjntegepmttmoonftnbuoiyrehfrtsabzsttorodklubbuyaetk",
|
||||
"ur:bytes/9-9/lpasascfadaxcywenbpljkhdcajskecpmdckihdyhphfotjojtfmlnwmadspaxrkytbztpbauotbgtgtaeaevtgavtny",
|
||||
"ur:bytes/10-9/lpbkascfadaxcywenbpljkhdcahkadaemejtswhhylkepmykhhtsytsnoyoyaxaedsuttydmmhhpktpmsrjtwdkiplzs",
|
||||
"ur:bytes/11-9/lpbdascfadaxcywenbpljkhdcahelbknlkuejnbadmssfhfrdpsbiegecpasvssovlgeykssjykklronvsjkvetiiapk",
|
||||
"ur:bytes/12-9/lpbnascfadaxcywenbpljkhdcarllaluzmdmgstospeyiefmwejlwtpedamktksrvlcygmzemovovllarodtmtbnptrs",
|
||||
"ur:bytes/13-9/lpbtascfadaxcywenbpljkhdcamtkgtpknghchchyketwsvwgwfdhpgmgtylctotzopdrpayoschcmhplffziachrfgd",
|
||||
"ur:bytes/14-9/lpbaascfadaxcywenbpljkhdcapazewnvonnvdnsbyleynwtnsjkjndeoldydkbkdslgjkbbkortbelomueekgvstegt",
|
||||
"ur:bytes/15-9/lpbsascfadaxcywenbpljkhdcaynmhpddpzmversbdqdfyrehnqzlugmjzmnmtwmrouohtstgsbsahpawkditkckynwt",
|
||||
"ur:bytes/16-9/lpbeascfadaxcywenbpljkhdcawygekobamwtlihsnpalnsghenskkiynthdzotsimtojetprsttmukirlrsbtamjtpd",
|
||||
"ur:bytes/17-9/lpbyascfadaxcywenbpljkhdcamklgftaxykpewyrtqzhydntpnytyisincxmhtbceaykolduortotiaiaiafhiaoyce",
|
||||
"ur:bytes/18-9/lpbgascfadaxcywenbpljkhdcahkadaemejtswhhylkepmykhhtsytsnoyoyaxaedsuttydmmhhpktpmsrjtntwkbkwy",
|
||||
"ur:bytes/19-9/lpbwascfadaxcywenbpljkhdcadekicpaajootjzpsdrbalpeywllbdsnbinaerkurspbncxgslgftvtsrjtksplcpeo",
|
||||
"ur:bytes/20-9/lpbbascfadaxcywenbpljkhdcayapmrleeleaxpasfrtrdkncffwjyjzgyetdmlewtkpktgllepfrltataztksmhkbot"
|
||||
};
|
||||
Assert.assertArrayEquals("", expectedParts, parts.toArray());
|
||||
}
|
||||
|
||||
@Test
|
||||
public void testMultipartUR() {
|
||||
UR ur = makeMessageUR(32767, "Wolf");
|
||||
int maxFragmentLen = 1000;
|
||||
UREncoder urEncoder = new UREncoder(ur, maxFragmentLen, 10, 100);
|
||||
URDecoder urDecoder = new URDecoder();
|
||||
|
||||
do {
|
||||
String part = urEncoder.nextPart();
|
||||
urDecoder.receivePart(part);
|
||||
} while(urDecoder.getResult() == null);
|
||||
|
||||
Assert.assertEquals(ResultType.SUCCESS, urDecoder.getResult().type);
|
||||
|
||||
UR decodedUR = urDecoder.getResult().ur;
|
||||
Assert.assertEquals(ur, decodedUR);
|
||||
}
|
||||
|
||||
public static byte[] makeMessage(int len, String seed) {
|
||||
RandomXoshiro256StarStar rng = new RandomXoshiro256StarStar(seed);
|
||||
byte[] message = new byte[len];
|
||||
rng.nextData(message);
|
||||
return message;
|
||||
}
|
||||
|
||||
private UR makeMessageUR(int len, String seed) {
|
||||
try {
|
||||
byte[] message = makeMessage(len, seed);
|
||||
|
||||
ByteArrayOutputStream baos = new ByteArrayOutputStream();
|
||||
new CborEncoder(baos).encode(new CborBuilder()
|
||||
.add(message)
|
||||
.build());
|
||||
byte[] cbor = baos.toByteArray();
|
||||
return new UR("bytes", cbor);
|
||||
} catch(Exception e) {
|
||||
throw new RuntimeException(e);
|
||||
}
|
||||
}
|
||||
|
||||
@Test
|
||||
public void testCbor() throws Exception {
|
||||
ByteArrayOutputStream baos = new ByteArrayOutputStream();
|
||||
new CborEncoder(baos).encode(new CborBuilder()
|
||||
.add(Utils.hexToBytes("00112233445566778899aabbccddeeff"))
|
||||
.build());
|
||||
|
||||
byte[] cbor = baos.toByteArray();
|
||||
Assert.assertEquals("5000112233445566778899aabbccddeeff", Utils.bytesToHex(cbor));
|
||||
|
||||
UR ur = new UR("bytes", cbor);
|
||||
String encoded = UREncoder.encode(ur);
|
||||
Assert.assertEquals("ur:bytes/gdaebycpeofygoiyktlonlpkrksfutwyzmwmfyeozs", encoded);
|
||||
}
|
||||
}
|
|
@ -1,242 +0,0 @@
|
|||
package com.sparrowwallet.sparrow.ur.fountain;
|
||||
|
||||
import co.nstant.in.cbor.CborException;
|
||||
import com.sparrowwallet.drongo.Utils;
|
||||
import com.sparrowwallet.sparrow.ur.ResultType;
|
||||
import com.sparrowwallet.sparrow.ur.URTest;
|
||||
import org.junit.Assert;
|
||||
import org.junit.Test;
|
||||
|
||||
import java.util.Arrays;
|
||||
import java.util.List;
|
||||
import java.util.stream.Collectors;
|
||||
import java.util.stream.IntStream;
|
||||
import java.util.zip.CRC32;
|
||||
|
||||
public class FountainCodesTest {
|
||||
@Test
|
||||
public void testRNG3() {
|
||||
RandomXoshiro256StarStar rng = new RandomXoshiro256StarStar("Wolf");
|
||||
int[] numbers = IntStream.range(0, 100).map(i -> rng.nextInt(1, 10)).toArray();
|
||||
int[] expectedNumbers = new int[] {6, 5, 8, 4, 10, 5, 7, 10, 4, 9, 10, 9, 7, 7, 1, 1, 2, 9, 9, 2, 6, 4, 5, 7, 8, 5, 4, 2, 3, 8, 7, 4, 5, 1, 10, 9, 3, 10, 2, 6, 8, 5, 7, 9, 3, 1, 5, 2, 7, 1, 4, 4, 4, 4, 9, 4, 5, 5, 6, 9, 5, 1, 2, 8, 3, 3, 2, 8, 4, 3, 2, 1, 10, 8, 9, 3, 10, 8, 5, 5, 6, 7, 10, 5, 8, 9, 4, 6, 4, 2, 10, 2, 1, 7, 9, 6, 7, 4, 2, 5};
|
||||
|
||||
Assert.assertArrayEquals(expectedNumbers, numbers);
|
||||
}
|
||||
|
||||
@Test
|
||||
public void testRandomSampler() {
|
||||
RandomXoshiro256StarStar rng = new RandomXoshiro256StarStar("Wolf");
|
||||
RandomSampler randomSampler = new RandomSampler(List.of(1d, 2d, 4d, 8d));
|
||||
int[] numbers = IntStream.range(0, 500).map(i -> randomSampler.next(rng)).toArray();
|
||||
int[] expectedNumbers = new int[] {3, 3, 3, 3, 3, 3, 3, 0, 2, 3, 3, 3, 3, 1, 2, 2, 1, 3, 3, 2, 3, 3, 1, 1, 2, 1, 1, 3, 1, 3, 1, 2, 0, 2, 1, 0, 3, 3, 3, 1, 3, 3, 3, 3, 1, 3, 2, 3, 2, 2, 3, 3, 3, 3, 2, 3, 3, 0, 3, 3, 3, 3, 1, 2, 3, 3, 2, 2, 2, 1, 2, 2, 1, 2, 3, 1, 3, 0, 3, 2, 3, 3, 3, 3, 3, 3, 3, 3, 2, 3, 1, 3, 3, 2, 0, 2, 2, 3, 1, 1, 2, 3, 2, 3, 3, 3, 3, 2, 3, 3, 3, 3, 3, 2, 3, 1, 2, 1, 1, 3, 1, 3, 2, 2, 3, 3, 3, 1, 3, 3, 3, 3, 3, 3, 3, 3, 2, 3, 2, 3, 3, 1, 2, 3, 3, 1, 3, 2, 3, 3, 3, 2, 3, 1, 3, 0, 3, 2, 1, 1, 3, 1, 3, 2, 3, 3, 3, 3, 2, 0, 3, 3, 1, 3, 0, 2, 1, 3, 3, 1, 1, 3, 1, 2, 3, 3, 3, 0, 2, 3, 2, 0, 1, 3, 3, 3, 2, 2, 2, 3, 3, 3, 3, 3, 2, 3, 3, 3, 3, 2, 3, 3, 2, 0, 2, 3, 3, 3, 3, 2, 1, 1, 1, 2, 1, 3, 3, 3, 2, 2, 3, 3, 1, 2, 3, 0, 3, 2, 3, 3, 3, 3, 0, 2, 2, 3, 2, 2, 3, 3, 3, 3, 1, 3, 2, 3, 3, 3, 3, 3, 2, 2, 3, 1, 3, 0, 2, 1, 3, 3, 3, 3, 3, 3, 3, 3, 1, 3, 3, 3, 3, 2, 2, 2, 3, 1, 1, 3, 2, 2, 0, 3, 2, 1, 2, 1, 0, 3, 3, 3, 2, 2, 3, 2, 1, 2, 0, 0, 3, 3, 2, 3, 3, 2, 3, 3, 3, 3, 3, 2, 2, 2, 3, 3, 3, 3, 3, 1, 1, 3, 2, 2, 3, 1, 1, 0, 1, 3, 2, 3, 3, 2, 3, 3, 2, 3, 3, 2, 2, 2, 2, 3, 2, 2, 2, 2, 2, 1, 2, 3, 3, 2, 2, 2, 2, 3, 3, 2, 0, 2, 1, 3, 3, 3, 3, 0, 3, 3, 3, 3, 2, 2, 3, 1, 3, 3, 3, 2, 3, 3, 3, 2, 3, 3, 3, 3, 2, 3, 2, 1, 3, 3, 3, 3, 2, 2, 0, 1, 2, 3, 2, 0, 3, 3, 3, 3, 3, 3, 1, 3, 3, 2, 3, 2, 2, 3, 3, 3, 3, 3, 2, 2, 3, 3, 2, 2, 2, 1, 3, 3, 3, 3, 1, 2, 3, 2, 3, 3, 2, 3, 2, 3, 3, 3, 2, 3, 1, 2, 3, 2, 1, 1, 3, 3, 2, 3, 3, 2, 3, 3, 0, 0, 1, 3, 3, 2, 3, 3, 3, 3, 1, 3, 3, 0, 3, 2, 3, 3, 1, 3, 3, 3, 3, 3, 3, 3, 0, 3, 3, 2};
|
||||
|
||||
Assert.assertArrayEquals(expectedNumbers, numbers);
|
||||
}
|
||||
|
||||
@Test
|
||||
public void testShuffle() {
|
||||
RandomXoshiro256StarStar rng = new RandomXoshiro256StarStar("Wolf");
|
||||
List<Integer> numbers = IntStream.range(1, 11).boxed().collect(Collectors.toList());
|
||||
numbers = FountainUtils.shuffled(numbers, rng);
|
||||
List<Integer> expectedNumbers = List.of(6, 4, 9, 3, 10, 5, 7, 8, 1, 2);
|
||||
|
||||
Assert.assertEquals(expectedNumbers, numbers);
|
||||
}
|
||||
|
||||
@Test
|
||||
public void testPartitionAndJoin() {
|
||||
byte[] message = URTest.makeMessage(1024, "Wolf");
|
||||
int fragmentLen = FountainEncoder.findNominalFragmentLength(message.length, 10, 100);
|
||||
List<byte[]> fragments = FountainEncoder.partitionMessage(message, fragmentLen);
|
||||
List<String> fragmentsHex = fragments.stream().map(Utils::bytesToHex).collect(Collectors.toList());
|
||||
String[] expectedFragmentsHex = new String[] {
|
||||
"916ec65cf77cadf55cd7f9cda1a1030026ddd42e905b77adc36e4f2d3ccba44f7f04f2de44f42d84c374a0e149136f25b01852545961d55f7f7a8cde6d0e2ec43f3b2dcb644a2209e8c9e34af5c4747984a5e873c9cf5f965e25ee29039f",
|
||||
"df8ca74f1c769fc07eb7ebaec46e0695aea6cbd60b3ec4bbff1b9ffe8a9e7240129377b9d3711ed38d412fbb4442256f1e6f595e0fc57fed451fb0a0101fb76b1fb1e1b88cfdfdaa946294a47de8fff173f021c0e6f65b05c0a494e50791",
|
||||
"270a0050a73ae69b6725505a2ec8a5791457c9876dd34aadd192a53aa0dc66b556c0c215c7ceb8248b717c22951e65305b56a3706e3e86eb01c803bbf915d80edcd64d4d41977fa6f78dc07eecd072aae5bc8a852397e06034dba6a0b570",
|
||||
"797c3a89b16673c94838d884923b8186ee2db5c98407cab15e13678d072b43e406ad49477c2e45e85e52ca82a94f6df7bbbe7afbed3a3a830029f29090f25217e48d1f42993a640a67916aa7480177354cc7440215ae41e4d02eae9a1912",
|
||||
"33a6d4922a792c1b7244aa879fefdb4628dc8b0923568869a983b8c661ffab9b2ed2c149e38d41fba090b94155adbed32f8b18142ff0d7de4eeef2b04adf26f2456b46775c6c20b37602df7da179e2332feba8329bbb8d727a138b4ba7a5",
|
||||
"03215eda2ef1e953d89383a382c11d3f2cad37a4ee59a91236a3e56dcf89f6ac81dd4159989c317bd649d9cbc617f73fe10033bd288c60977481a09b343d3f676070e67da757b86de27bfca74392bac2996f7822a7d8f71a489ec6180390",
|
||||
"089ea80a8fcd6526413ec6c9a339115f111d78ef21d456660aa85f790910ffa2dc58d6a5b93705caef1091474938bd312427021ad1eeafbd19e0d916ddb111fabd8dcab5ad6a6ec3a9c6973809580cb2c164e26686b5b98cfb017a337968",
|
||||
"c7daaa14ae5152a067277b1b3902677d979f8e39cc2aafb3bc06fcf69160a853e6869dcc09a11b5009f91e6b89e5b927ab1527a735660faa6012b420dd926d940d742be6a64fb01cdc0cff9faa323f02ba41436871a0eab851e7f5782d10",
|
||||
"fbefde2a7e9ae9dc1e5c2c48f74f6c824ce9ef3c89f68800d44587bedc4ab417cfb3e7447d90e1e417e6e05d30e87239d3a5d1d45993d4461e60a0192831640aa32dedde185a371ded2ae15f8a93dba8809482ce49225daadfbb0fec629e",
|
||||
"23880789bdf9ed73be57fa84d555134630e8d0f7df48349f29869a477c13ccca9cd555ac42ad7f568416c3d61959d0ed568b2b81c7771e9088ad7fd55fd4386bafbf5a528c30f107139249357368ffa980de2c76ddd9ce4191376be0e6b5",
|
||||
"170010067e2e75ebe2d2904aeb1f89d5dc98cd4a6f2faaa8be6d03354c990fd895a97feb54668473e9d942bb99e196d897e8f1b01625cf48a7b78d249bb4985c065aa8cd1402ed2ba1b6f908f63dcd84b66425df00000000000000000000"
|
||||
};
|
||||
|
||||
Assert.assertEquals(Arrays.asList(expectedFragmentsHex), fragmentsHex);
|
||||
|
||||
byte[] rejoinedMessage = FountainDecoder.joinFragments(fragments, message.length);
|
||||
Assert.assertArrayEquals(message, rejoinedMessage);
|
||||
}
|
||||
|
||||
@Test
|
||||
public void testChooseDegree() {
|
||||
byte[] message = URTest.makeMessage(1024, "Wolf");
|
||||
int fragmentLen = FountainEncoder.findNominalFragmentLength(message.length, 10, 100);
|
||||
List<byte[]> fragments = FountainEncoder.partitionMessage(message, fragmentLen);
|
||||
List<Integer> degrees = IntStream.rangeClosed(1, 200).mapToObj( nonce -> {
|
||||
RandomXoshiro256StarStar partRng = new RandomXoshiro256StarStar("Wolf-" + nonce);
|
||||
return FountainUtils.chooseDegree(fragments.size(), partRng);
|
||||
}).collect(Collectors.toList());
|
||||
Integer[] expectedDegrees = new Integer[] {
|
||||
11, 3, 6, 5, 2, 1, 2, 11, 1, 3, 9, 10, 10, 4, 2, 1, 1, 2, 1, 1, 5, 2, 4, 10, 3, 2, 1, 1, 3, 11, 2, 6, 2, 9, 9, 2, 6, 7, 2, 5, 2, 4, 3, 1, 6, 11, 2, 11, 3, 1, 6, 3, 1, 4, 5, 3, 6, 1, 1, 3, 1, 2, 2, 1, 4, 5, 1, 1, 9, 1, 1, 6, 4, 1, 5, 1, 2, 2, 3, 1, 1, 5, 2, 6, 1, 7, 11, 1, 8, 1, 5, 1, 1, 2, 2, 6, 4, 10, 1, 2, 5, 5, 5, 1, 1, 4, 1, 1, 1, 3, 5, 5, 5, 1, 4, 3, 3, 5, 1, 11, 3, 2, 8, 1, 2, 1, 1, 4, 5, 2, 1, 1, 1, 5, 6, 11, 10, 7, 4, 7, 1, 5, 3, 1, 1, 9, 1, 2, 5, 5, 2, 2, 3, 10, 1, 3, 2, 3, 3, 1, 1, 2, 1, 3, 2, 2, 1, 3, 8, 4, 1, 11, 6, 3, 1, 1, 1, 1, 1, 3, 1, 2, 1, 10, 1, 1, 8, 2, 7, 1, 2, 1, 9, 2, 10, 2, 1, 3, 4, 10
|
||||
};
|
||||
Assert.assertEquals(Arrays.asList(expectedDegrees), degrees);
|
||||
}
|
||||
|
||||
@Test
|
||||
public void testChooseFragment() {
|
||||
byte[] message = URTest.makeMessage(1024, "Wolf");
|
||||
CRC32 crc32 = new CRC32();
|
||||
crc32.update(message);
|
||||
long checksum = crc32.getValue();
|
||||
int fragmentLen = FountainEncoder.findNominalFragmentLength(message.length, 10, 100);
|
||||
List<byte[]> fragments = FountainEncoder.partitionMessage(message, fragmentLen);
|
||||
List<List<Integer>> partIndexes = IntStream.rangeClosed(1, 30).mapToObj(nonce -> {
|
||||
return FountainUtils.chooseFragments(nonce, fragments.size(), checksum).stream().sorted().collect(Collectors.toList());
|
||||
}).collect(Collectors.toList());
|
||||
|
||||
Integer[][] expectedFragmentIndexes = new Integer[][] {
|
||||
{0},
|
||||
{1},
|
||||
{2},
|
||||
{3},
|
||||
{4},
|
||||
{5},
|
||||
{6},
|
||||
{7},
|
||||
{8},
|
||||
{9},
|
||||
{10},
|
||||
{9},
|
||||
{2, 5, 6, 8, 9, 10},
|
||||
{8},
|
||||
{1, 5},
|
||||
{1},
|
||||
{0, 2, 4, 5, 8, 10},
|
||||
{5},
|
||||
{2},
|
||||
{2},
|
||||
{0, 1, 3, 4, 5, 7, 9, 10},
|
||||
{0, 1, 2, 3, 5, 6, 8, 9, 10},
|
||||
{0, 2, 4, 5, 7, 8, 9, 10},
|
||||
{3, 5},
|
||||
{4},
|
||||
{0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10},
|
||||
{0, 1, 3, 4, 5, 6, 7, 9, 10},
|
||||
{6},
|
||||
{5, 6},
|
||||
{7}
|
||||
};
|
||||
|
||||
List<List<Integer>> expectedPartIndexes = Arrays.stream(expectedFragmentIndexes).map(Arrays::asList).collect(Collectors.toList());
|
||||
Assert.assertEquals(expectedPartIndexes, partIndexes);
|
||||
}
|
||||
|
||||
@Test
|
||||
public void testXOR() {
|
||||
RandomXoshiro256StarStar rng = new RandomXoshiro256StarStar("Wolf");
|
||||
byte[] data1 = new byte[10];
|
||||
rng.nextData(data1);
|
||||
Assert.assertEquals("916ec65cf77cadf55cd7", Utils.bytesToHex(data1));
|
||||
|
||||
byte[] data2 = new byte[10];
|
||||
rng.nextData(data2);
|
||||
Assert.assertEquals("f9cda1a1030026ddd42e", Utils.bytesToHex(data2));
|
||||
|
||||
byte[] data3 = FountainEncoder.xor(data1, data2);
|
||||
Assert.assertEquals("68a367fdf47c8b2888f9", Utils.bytesToHex(data3));
|
||||
}
|
||||
|
||||
@Test
|
||||
public void testEncoderCBOR() {
|
||||
byte[] message = URTest.makeMessage(256, "Wolf");
|
||||
FountainEncoder encoder = new FountainEncoder(message, 30, 10, 0);
|
||||
List<FountainEncoder.Part> parts = IntStream.range(0, 20).mapToObj(i -> encoder.nextPart()).collect(Collectors.toList());
|
||||
List<String> partsHex = parts.stream().map(part -> Utils.bytesToHex(part.toCborBytes())).collect(Collectors.toList());
|
||||
String[] expectedPartsHex = new String[] {
|
||||
"8501091901001a0167aa07581d916ec65cf77cadf55cd7f9cda1a1030026ddd42e905b77adc36e4f2d3c",
|
||||
"8502091901001a0167aa07581dcba44f7f04f2de44f42d84c374a0e149136f25b01852545961d55f7f7a",
|
||||
"8503091901001a0167aa07581d8cde6d0e2ec43f3b2dcb644a2209e8c9e34af5c4747984a5e873c9cf5f",
|
||||
"8504091901001a0167aa07581d965e25ee29039fdf8ca74f1c769fc07eb7ebaec46e0695aea6cbd60b3e",
|
||||
"8505091901001a0167aa07581dc4bbff1b9ffe8a9e7240129377b9d3711ed38d412fbb4442256f1e6f59",
|
||||
"8506091901001a0167aa07581d5e0fc57fed451fb0a0101fb76b1fb1e1b88cfdfdaa946294a47de8fff1",
|
||||
"8507091901001a0167aa07581d73f021c0e6f65b05c0a494e50791270a0050a73ae69b6725505a2ec8a5",
|
||||
"8508091901001a0167aa07581d791457c9876dd34aadd192a53aa0dc66b556c0c215c7ceb8248b717c22",
|
||||
"8509091901001a0167aa07581d951e65305b56a3706e3e86eb01c803bbf915d80edcd64d4d0000000000",
|
||||
"850a091901001a0167aa07581d330f0f33a05eead4f331df229871bee733b50de71afd2e5a79f196de09",
|
||||
"850b091901001a0167aa07581d3b205ce5e52d8c24a52cffa34c564fa1af3fdffcd349dc4258ee4ee828",
|
||||
"850c091901001a0167aa07581ddd7bf725ea6c16d531b5f03254783803048ca08b87148daacd1cd7a006",
|
||||
"850d091901001a0167aa07581d760be7ad1c6187902bbc04f539b9ee5eb8ea6833222edea36031306c01",
|
||||
"850e091901001a0167aa07581d5bf4031217d2c3254b088fa7553778b5003632f46e21db129416f65b55",
|
||||
"850f091901001a0167aa07581d73f021c0e6f65b05c0a494e50791270a0050a73ae69b6725505a2ec8a5",
|
||||
"8510091901001a0167aa07581db8546ebfe2048541348910267331c643133f828afec9337c318f71b7df",
|
||||
"8511091901001a0167aa07581d23dedeea74e3a0fb052befabefa13e2f80e4315c9dceed4c8630612e64",
|
||||
"8512091901001a0167aa07581dd01a8daee769ce34b6b35d3ca0005302724abddae405bdb419c0a6b208",
|
||||
"8513091901001a0167aa07581d3171c5dc365766eff25ae47c6f10e7de48cfb8474e050e5fe997a6dc24",
|
||||
"8514091901001a0167aa07581de055c2433562184fa71b4be94f262e200f01c6f74c284b0dc6fae6673f"
|
||||
};
|
||||
|
||||
Assert.assertEquals(Arrays.asList(expectedPartsHex), partsHex);
|
||||
}
|
||||
|
||||
@Test
|
||||
public void testEncoderIsComplete() {
|
||||
byte[] message = URTest.makeMessage(256, "Wolf");
|
||||
FountainEncoder encoder = new FountainEncoder(message, 30, 10, 0);
|
||||
int generatedPartsCount = 0;
|
||||
while(!encoder.isComplete()) {
|
||||
encoder.nextPart();
|
||||
generatedPartsCount++;
|
||||
}
|
||||
|
||||
Assert.assertEquals(encoder.getSeqLen(), generatedPartsCount);
|
||||
}
|
||||
|
||||
@Test
|
||||
public void testDecoder() {
|
||||
String messageSeed = "Wolf";
|
||||
int messageSize = 32767;
|
||||
int maxFragmentLen = 1000;
|
||||
|
||||
byte[] message = URTest.makeMessage(messageSize, messageSeed);
|
||||
FountainEncoder encoder = new FountainEncoder(message, maxFragmentLen, 10, 0);
|
||||
FountainDecoder decoder = new FountainDecoder();
|
||||
|
||||
do {
|
||||
FountainEncoder.Part part = encoder.nextPart();
|
||||
decoder.receivePart(part);
|
||||
} while(decoder.getResult() == null);
|
||||
|
||||
Assert.assertEquals(ResultType.SUCCESS, decoder.getResult().type);
|
||||
Assert.assertArrayEquals(message, decoder.getResult().data);
|
||||
}
|
||||
|
||||
@Test
|
||||
public void testDecoderHighFirstSeq() {
|
||||
String messageSeed = "Wolf";
|
||||
int messageSize = 32767;
|
||||
int maxFragmentLen = 1000;
|
||||
|
||||
byte[] message = URTest.makeMessage(messageSize, messageSeed);
|
||||
FountainEncoder encoder = new FountainEncoder(message, maxFragmentLen, 10, 100);
|
||||
FountainDecoder decoder = new FountainDecoder();
|
||||
|
||||
do {
|
||||
FountainEncoder.Part part = encoder.nextPart();
|
||||
decoder.receivePart(part);
|
||||
} while(decoder.getResult() == null);
|
||||
|
||||
Assert.assertEquals(ResultType.SUCCESS, decoder.getResult().type);
|
||||
Assert.assertArrayEquals(message, decoder.getResult().data);
|
||||
}
|
||||
|
||||
@Test
|
||||
public void testCBOR() throws CborException {
|
||||
FountainEncoder.Part part = new FountainEncoder.Part(12, 8, 100, 0x12345678, new byte[] {1,5,3,3,5});
|
||||
byte[] cbor = part.toCborBytes();
|
||||
FountainEncoder.Part part2 = FountainEncoder.Part.fromCborBytes(cbor);
|
||||
|
||||
Assert.assertArrayEquals(cbor, part2.toCborBytes());
|
||||
}
|
||||
}
|
Loading…
Reference in a new issue